PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.15G005100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family GRAS
Protein Properties Length: 585aa    MW: 66014.5 Da    PI: 5.0855
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.15G005100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS282.89.7e-872115821374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn...sseelaalklfsev 87 
                          lve Ll+ Ae v ++++e+a++lL+   + +s +g+p+qR+++yf eAL++r++  + +++++   +++s++    +++   a  + +e 
  Manes.15G005100.1.p 211 LVEFLLASAEKVGHQQFERASRLLKYCDNFSSGTGNPVQRVVHYFSEALRERINLGTGRISSKGFWKKQSSDLnqeMTTLNEASLACHER 300
                          57889*************************************************9666666655433333333232333333334499** PP

                 GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                           P+++++ +t  qaI + v+g++r+HiiD++i  G+QWp L+qaL sR   +   l+i ++g    +sk+++e tg+rLa+fAe++++pf
  Manes.15G005100.1.p 301 IPFFQVARFTGIQAIIDNVAGAKRIHIIDLEIRCGAQWPVLMQALVSRYdCPLELLKISAIGT---SSKQMIEDTGKRLASFAESMDIPF 387
                          ************************************************9445569********...58********************** PP

                 GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                          +f+v+++ ++ dl+ + ++++ +Ea+a+ + ++ ++l   +  les    ++++++++ P+v+vv+e ea+ ns+sF++rf+e+l +y +
  Manes.15G005100.1.p 388 SFKVVMVPDMLDLKEDLFELDAEEAIAIYSEYSFMSLIFVPNRLES----IMRVLRNIIPRVMVVMEVEANNNSPSFVKRFIESLFFYGS 473
                          ****9999*****************************966666666....**************************************** PP

                 GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveees 355
                           fd+++a ++r++ +r+  E  ++++ i+n+va+eg+er+ rh +   Wr+ + ++G  + +ls++   qa+l+l+k++ +   ++  ++
  Manes.15G005100.1.p 474 YFDCFDACMGRDDPNRVITELIFFHQGIRNIVAKEGEERIIRHVKIDVWRSFFARFGIIETELSTSSLYQASLVLKKFDcGSSCTLGMNE 563
                          *******************************************************************************9999******* PP

                 GRAS 356 gslvlgWkdrpLvsvSaWr 374
                          +sl++gWk+ p+ s+S+W+
  Manes.15G005100.1.p 564 KSLLIGWKGTPMHSLSVWK 582
                          ******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.535185561IPR005202Transcription factor GRAS
PfamPF035143.3E-84211582IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MANAIFPLEE YNFGGIWDDL TSTSKSPKNL DGVNMGKIGR LFGSENWGDD GGTDYGFNQE  60
LVEEGLLFSK YQQQSYLDYE VFDDRSFDIL SPTLLPCMEE IAKLGKISGG IQDASESKKK  120
NQHDFSYASL ELLKKYDIGR LSGRQIVQPR CDAQYTKFAS QELSTEEIIR IAGARFIQSS  180
CEVVGIPSML KNPIGLSFSE LSDEAAKNVE LVEFLLASAE KVGHQQFERA SRLLKYCDNF  240
SSGTGNPVQR VVHYFSEALR ERINLGTGRI SSKGFWKKQS SDLNQEMTTL NEASLACHER  300
IPFFQVARFT GIQAIIDNVA GAKRIHIIDL EIRCGAQWPV LMQALVSRYD CPLELLKISA  360
IGTSSKQMIE DTGKRLASFA ESMDIPFSFK VVMVPDMLDL KEDLFELDAE EAIAIYSEYS  420
FMSLIFVPNR LESIMRVLRN IIPRVMVVME VEANNNSPSF VKRFIESLFF YGSYFDCFDA  480
CMGRDDPNRV ITELIFFHQG IRNIVAKEGE ERIIRHVKID VWRSFFARFG IIETELSTSS  540
LYQASLVLKK FDCGSSCTLG MNEKSLLIGW KGTPMHSLSV WKFT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-3724158233375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012084259.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A067K7Y30.0A0A067K7Y3_JATCU; GRAS40 protein
STRINGPOPTR_0010s15370.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-52RGA-like 1